PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676724184
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ZF-HD
Protein Properties Length: 124aa    MW: 13708.6 Da    PI: 7.8422
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676724184genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer27.85.8e-09658259
  ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                 ++v+Y eC      ++ g   D C  f+++ geeg ++a+ C  CgCH  FH ++ve+
    676724184  6 KTVTYGECVN----KIRGVKKDYCAHFIAA-GEEGMPEAFFCRGCGCHLCFHEKHVET 58
                 6789999974....789999*********9.999********************9876 PP

2ZF-HD_dimer90.41.7e-2865118256
  ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 
                  ++vrY eC kNhA ++Gg+ vDGCgEf+++ ge+gt++al CaACgCHR+FH+++
    676724184  65 ATVRYGECVKNHAPNTGGNWVDGCGEFVAA-GEKGTPEALSCAACGCHRSFHKKR 118
                  579**************************9.999******************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-5658IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.6E-7856IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-1565119IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.9E-2767118IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.6E-2468118IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.41269118IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MGHWKKTVTY GECVNKIRGV KKDYCAHFIA AGEEGMPEAF FCRGCGCHLC FHEKHVETNY  60
DRSDATVRYG ECVKNHAPNT GGNWVDGCGE FVAAGEKGTP EALSCAACGC HRSFHKKRVL  120
LICY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010454130.16e-52PREDICTED: zinc-finger homeodomain protein 8-like
TrEMBLV7CEI22e-21V7CEI2_PHAVU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1748978
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.14e-21mini zinc finger 1